PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG312300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 25620.5 Da    PI: 10.1389
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG312300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.78.8e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye+ss
  Pavir.9KG312300.1.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFSS 59
                         79***********************************************96 PP

2K-box67.44.8e-2377172398
                K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                          + s+k++ +++ ++ + ++  L +++e L+ ++R++lGe+Le +s++eL++Le +Leksl  iR kK++ll +qi +l++ke+ l ++nk
  Pavir.9KG312300.1.p  77 NLSNKDTRQQDIQQVKADALSLANRLEALEMTKRKFLGENLEGCSVEELHSLEVKLEKSLHVIRGKKTQLLEQQIAKLKEKERTLLKDNK 166
                          5788889999******************************************************************************** PP

                K-box  93 aLrkkl 98 
                          +Lr+k 
  Pavir.9KG312300.1.p 167 ELREKQ 172
                          ***996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-40160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-30323IPR002100Transcription factor, MADS-box
CDDcd002651.31E-41379No hitNo description
SuperFamilySSF554551.7E-32384IPR002100Transcription factor, MADS-box
PfamPF003191.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2484171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.04788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIVFSP RGKLYEFSSA  60
SSLQKTIDRY KSYTRENLSN KDTRQQDIQQ VKADALSLAN RLEALEMTKR KFLGENLEGC  120
SVEELHSLEV KLEKSLHVIR GKKTQLLEQQ IAKLKEKERT LLKDNKELRE KQRAVQPPLV  180
APAVTRCLPP WLRNLPAPCN DGVDVETELY IGLPGRERSA NRDSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-16382282Myocyte-specific enhancer factor 2A
3kov_B2e-16382282Myocyte-specific enhancer factor 2A
3kov_I2e-16382282Myocyte-specific enhancer factor 2A
3kov_J2e-16382282Myocyte-specific enhancer factor 2A
3p57_A2e-16382282Myocyte-specific enhancer factor 2A
3p57_B2e-16382282Myocyte-specific enhancer factor 2A
3p57_C2e-16382282Myocyte-specific enhancer factor 2A
3p57_D2e-16382282Myocyte-specific enhancer factor 2A
3p57_I2e-16382282Myocyte-specific enhancer factor 2A
3p57_J2e-16382282Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.112840.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-146PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-107MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-132C0P954_MAIZE; MADS transcription factor
STRINGSb01g030570.11e-136(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-70AGAMOUS-like 19